The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the LIM domain of human Leupaxin. To be Published
    Site RSGI
    PDB Id 1x3h Target Id hss001003110.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13313, Molecular Weight 7698.34 Da.
    Residues 67 Isoelectric Point 6.03
    Sequence kdflamfspkcggcnrpvlenylsamdtvwhpecfvcgdcftsfstgsffeldgrpfcelhyhhrrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1x3h

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch