The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the FAS1 domain of human transforming growth factor-beta induced protein IG-H3. To be Published
    Site RSGI
    PDB Id 1x3b Target Id hss001001558.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13265, Molecular Weight 14336.82 Da.
    Residues 133 Isoelectric Point 6.10
    Sequence mgtvmdvlkgdnrfsmlvaaiqsagltetlnregvytvfaptneafralpprersrllgdakelanilk yhigdeilvsggigalvrlkslqgdklevslknnvvsvnkepvaepdimatngvvhvitnvlqp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x3b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch