.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x2l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CUT domain of human homeobox protein Cux-2 (Cut-like 2). To be Published
    Site RSGI
    PDB Id 1x2l Target Id hsk002100285.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12700, Molecular Weight 9941.04 Da.
    Residues 88 Isoelectric Point 9.46
    Sequence agpgaeeeqldtaeiafqvkeqllkhnigqrvfghyvlglsqgsvseilarpkpwrkltvkgkepfikm kqflsdeqnvlalrtiqvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x2l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch