The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tryptophan synthase beta chain from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1x1q Target Id ttk003000018.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14162, Molecular Weight 45337.41 Da.
    Residues 418 Isoelectric Point 6.21
    Sequence mgvvlargafrersmltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdpafleeldhy lrqfagrptplyhakrlseywggaqvflkredllhtgahkinntlgqallarrmgkrrviaetgagqhg vsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrpvaagsrtlkdatneairdwitnvrttf yilgsvvgphpypmmvrdfqsvigeevkrqslelfgrlpdaliaavgggsnaiglfapfaylpegrpkl igveaageglstgrhaasigagkrgvlhgsymyllydhdgqitpahsvsagldypgvgpehsyyadagv aeyasvtdeealegfkllarlegiipalesahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllggel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.245
    Matthews' coefficent 2.06 Rfactor 0.201
    Waters 302 Solvent Content 40.36

    Ligand Information
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 1x1q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch