The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C-terminal PH domain of human pleckstrin 2. To be Published
    Site RSGI
    PDB Id 1x1g Target Id hss001002623.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13299, Molecular Weight 13049.24 Da.
    Residues 116 Isoelectric Point 9.80
    Sequence slstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrpvggfslrgslvsaled ngvptgvkgnvqgnlfkvitkddthyyiqasskaeraewieaikklt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1x1g

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch