.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TT0495 protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1x1e Target Id ttk003000495.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14382, Molecular Weight 25671.29 Da.
    Residues 239 Isoelectric Point 7.79
    Sequence merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglvkralealg glhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagwgrvlfigsvttftaggp vpipayttaktallgltralakewarlgirvnllcpgyveteftlplrqnpelyepitaripmgrwarp eeiarvaavlcgdeaeyltgqavavdggflay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.215
    Matthews' coefficent 2.20 Rfactor 0.203
    Waters 181 Solvent Content 42.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x1e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch