.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x0a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of type II malate/lactate dehydrogenase from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1x0a Target Id ttk003001327.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14685, Molecular Weight 36945.28 Da.
    Residues 344 Isoelectric Point 6.48
    Sequence mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleaglvnpsptlpl eergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmaglyaeklaregfvawvttn aepdvvpfggrekalgtnplafaapapqgilvadlatsesamgkvflarekgerippswgvdregsptd dphrvyalrplggpkgyalallvevlsgvltgagvahgigrmydewdrpqdvghfllaldpgrfvgkea flermgalwqalkatppapgheevflpgelearrreralaegmalpervvaelkalgerygvpwrdda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.199
    Matthews' coefficent 4.91 Rfactor 0.184
    Waters 272 Solvent Content 75.00

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 1x0a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch