.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wzo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the HpcE from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wzo Target Id ttk003000364.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14349, Molecular Weight 27729.45 Da.
    Residues 246 Isoelectric Point 5.27
    Sequence mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyadhaeelglsrpeepa lfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyvlgytiandlvardyvtnt frppirakgrdtflplgpflvveevedpqdlwlrayvngelrqeghtsrmlysvaellefisefmtlep ydvlltgtpkgisqvrpgdvmrleieglgalenpieeep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.234
    Matthews' coefficent 2.79 Rfactor 0.211
    Waters 834 Solvent Content 55.91

    Ligand Information
    Ligands GOL (GLYCEROL) x 6;SO4 (SULFATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1wzo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch