.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wzn Target Id pho001001305.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13985, Molecular Weight 29864.07 Da.
    Residues 252 Isoelectric Point 5.47
    Sequence myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlelaergyevvgl dlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfdeedlrklfskvaealkpg gvfitdfpcwfyggrdgpvvwneqkgeeklvimdwrevepavqklrfkrlvqilrpngevkaflvddel niytprevrllaekyfekvkiygnlkrelspndmrywivgiaksf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.233
    Matthews' coefficent 2.90 Rfactor 0.209
    Waters 615 Solvent Content 57.80

    Ligand Information
    Ligands SO4 (SULFATE) x 3;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 3
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1wzn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch