.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wz8 Target Id ttk003000149.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14250, Molecular Weight 28777.12 Da.
    Residues 264 Isoelectric Point 6.38
    Sequence mlaslearypglafawprpgvleitfrgeklxamppalhrglarvwrdleavegvravllrgeggvfsa ggsfglieemrasheallrvfweardlvlgplxfprpvvaavekvavgaglalalaadiavvgkgtrll dghlrlgvaagdhavllwpllvgmakakyhlllxepltgeeaerlglvalavedekvyekalevaerla qgpkealhhtkhalxhwyrsflphfelslaleflgfsgkeleeglkalkekrppefp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.2584
    Matthews' coefficent 2.04 Rfactor 0.2235
    Waters 1548 Solvent Content 0.40

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 8
    Metals

    Jmol

     
    Google Scholar output for 1wz8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch