The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Leucyl-tRNA synthetase and tRNA(leucine) complex. to be published
    Site RSGI
    PDB Id 1wz2 Target Id pho001000965.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13953, Molecular Weight 113943.50 Da.
    Residues 967 Isoelectric Point 5.86
    Sequence maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdviarfkrm qgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpinivkyfmkaaketfi ragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrvrwdpvvgtplgdhdlmegedvpil dyiiikfelrengeviylpaatlrpetvygvtnmwvnpnatyvkakvrrkdkeetwivskeaayklsfq dreievieefkgekligkyvrnpvsgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkretei lekydidprivenityisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvpp yegkpvqevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekarkale rmkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqeg kldpekltpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhltff ifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyimslaehdsdfdwr rkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaikettnaleefrtrtavqwafys imndlrwylrrtegrddeakryvlrtladvwvrlmapftphiceelweklggegfvslakwpepveeww netieaeeefirsvmedikeiievakienakrayiytaedwkwkvaevvsekrdfkssmeelmkdseir khgkevakivqklikertfdvkrineekalreakefmekelgieiiinptedkggkkkqamplkpaifie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.21 Rfree 0.305
    Matthews' coefficent 2.89 Rfactor 0.241
    Waters Solvent Content 57.41

    Ligand Information


    Google Scholar output for 1wz2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch