The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of P-protein of the glycine cleavage system: implications for nonketotic hyperglycinemia. Embo J. 24 1523-1536 2005
    Site RSGI
    PDB Id 1wyt Target Id ttk003000355.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14342, Molecular Weight 52705.99 Da.
    Residues 474 Isoelectric Point 7.79
    Sequence msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrqvgvdttfy plgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltgmdaitlepaagahgelt giliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvreipsgpegevdlealkrelgphvaal mltnpntlglferrileisrlckeagvqlyydganlnaimgwarpgdmgfdvvhlnlhktftvphgggg pgsgpvgvkahlapylpvplvergeegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkka aalavlnarylkellkekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkeal mvepteteaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.237
    Matthews' coefficent 2.15 Rfactor 0.177
    Waters 1024 Solvent Content 42.00

    Ligand Information


    Google Scholar output for 1wyt

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch