The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CH domain of human Rho guanine nucleotide exchange factor 6. To be Published
    Site RSGI
    PDB Id 1wyr Target Id hsk001000001.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12560, Molecular Weight 11950.15 Da.
    Residues 108 Isoelectric Point 4.58
    Sequence eeqivtwlislgvlespkkticdpeeflksslkngvvlcklinrlmpgsvekfcldpqteadcinnind flkgcatlqveifdpddlysgvnfskvlstllavnkate
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wyr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch