The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the PH0671 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wy1 Target Id pho001000671.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13847, Molecular Weight 19461.51 Da.
    Residues 172 Isoelectric Point 5.70
    Sequence mrittkvgdkgstrlfggeevwkdspiieangtldeltsfigeakhyvdeemkgileeiqndiykimge igskgkiegiseerikwleglisryeemvnlksfvlpggtlesakldvcrtiarraerkvatvlrefgi gkealvylnrlsdllfllarvieieknklkevrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.227
    Matthews' coefficent 2.11 Rfactor 0.202
    Waters 290 Solvent Content 41.71

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 1wy1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch