.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wy0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of geranylgeranyl pyrophosphate synthetase from Pyrococcus horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 1wy0 Target Id pho001001072.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13971, Molecular Weight 38549.58 Da.
    Residues 342 Isoelectric Point 5.93
    Sequence mekyeelfarikekaklidekifelipekdprvlyeaarhyplaggkrvrpfvvltsteavggdplrai ypavaielihnyslvhddimdmdetrrgkptvhriwgvnmailagdllfskafeavaraeippekkarv levivkasnelcegqardlefekkstvtieeymemisgktgalfeasakvggiigtdneeyikalsswg rnvgiafqiwddvldliadekklgkpvgsdirkgkktlivahffenadekdkqrflkifgkyagdvkgr giieediksdvmeaidllkkygsidyaaeiakdmikkanealrilpkskarmdlellakfiverey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.263
    Matthews' coefficent 2.50 Rfactor 0.246
    Waters 177 Solvent Content 51.50

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 1;HG (MERCURY) x 1

    Jmol

     
    Google Scholar output for 1wy0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch