The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1. To be Published
    Site RSGI
    PDB Id 1wxv Target Id hss001001250.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13249, Molecular Weight 8627.53 Da.
    Residues 79 Isoelectric Point 6.31
    Sequence ltvtvthsnekhdlhvtsqqgssepvvqdlaqvveevigvpqsfqklifkgkslkemetplsalgiqdg crvmligkkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wxv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch