The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of Tryptophan Synthase A-Subunit with Indole-3-propanol phosphate From Thermus Thermophilus Hb8. To be Published
    Site RSGI
    PDB Id 1wxj Target Id ttk003000017.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14161, Molecular Weight 28944.94 Da.
    Residues 271 Isoelectric Point 6.05
    Sequence mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgpviqrasela lrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvilpdlppdedpglvr laqeigletvfllaptstdariatvvrhatgfvyavsvtgvtgmrerlpeevkdlvrrikartalpvav gfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrleanpglkesskkplp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.21
    Matthews' coefficent 2.16 Rfactor 0.189
    Waters 278 Solvent Content 43.00

    Ligand Information
    Ligands SO4 (SULFATE) x 4;IPL (INDOLE-3-PROPANOL) x 1


    Google Scholar output for 1wxj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch