.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wx9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the N-terminal Ubiquitin-like Domain in the Human BAT3 Protein. To be Published
    Site RSGI
    PDB Id 1wx9 Target Id hsi002005121.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12382, Molecular Weight 8291.21 Da.
    Residues 73 Isoelectric Point 9.11
    Sequence levlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkklqeynvggkvihlv erap
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wx9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch