The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein. To be Published
    Site RSGI
    PDB Id 1wx8 Target Id mmt007005678.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13484, Molecular Weight 9516.47 Da.
    Residues 83 Isoelectric Point 10.02
    Sequence vsgrepssriirvsvktpqdchefflaensnvrrfkkqiskylhcnadrlvliftgkilrdqdilsqrg ildgstvhvvvrsh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wx8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch