.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wx0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transaldolase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wx0 Target Id ttk003000502.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14392, Molecular Weight 24021.53 Da.
    Residues 223 Isoelectric Point 5.57
    Sequence melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvggpvsaevta leaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifsanqallaaragasyvspf lgrvddiswdggellreivemiqvqdlpvkviaasirhprhvteaallgadiatmphavfkqllkhplt diglkrfledwekvkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.27 Rfree 0.239
    Matthews' coefficent 2.44 Rfactor 0.196
    Waters 1313 Solvent Content 49.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wx0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch