.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wwx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ETS-domain of the Ets domain transcription factor. To be Published
    Site RSGI
    PDB Id 1wwx Target Id hss001002867.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13308, Molecular Weight 11409.52 Da.
    Residues 94 Isoelectric Point 9.30
    Sequence sshlwefvrdlllspeencgilewedreqgifrvvksealakmwgqrkkndrmtyeklsralryyyktg ilervdrrlvykfgknahgwqedkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wwx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch