The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1. To be Published
    Site RSGI
    PDB Id 1wwv Target Id hss001001485.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13257, Molecular Weight 8759.46 Da.
    Residues 78 Isoelectric Point 4.40
    Sequence mepvetwtpgkvatwlrglddslqdypfedwqlpgknllqlcpqslealavrslghqelilggveqlqa lssrlqten
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wwv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch