The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wwm Target Id ttk003002028.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14825, Molecular Weight 22059.42 Da.
    Residues 190 Isoelectric Point 4.75
    Sequence mgmlgldllkevpglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalm atveeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvpeegpwae lsqhwfapefqavlydlevlarglwedldpevvrtylrrileaekatwslll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.61 Rfree 0.275
    Matthews' coefficent 2.43 Rfactor 0.234
    Waters 116 Solvent Content 48.43

    Ligand Information


    Google Scholar output for 1wwm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch