.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wwh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of mouse Nup35 reveals atypical RNP motifs and novel homodimerization of the RRM domain. J.Mol.Biol. 363 114-124 2006
    Site RSGI
    PDB Id 1wwh Target Id mmt007120512.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13611, Molecular Weight 11899.90 Da.
    Residues 106 Isoelectric Point 7.34
    Sequence pfytqgdsltsedhlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkal skdgrifgesimigvkpcidknvmensdrgvlsspsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.234
    Matthews' coefficent 3.30 Rfactor 0.211
    Waters 32 Solvent Content 62.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wwh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch