.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ww8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of malic enzyme from Pyrococcus horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 1ww8 Target Id pho001001275.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13980, Molecular Weight 48001.00 Da.
    Residues 439 Isoelectric Point 6.16
    Sequence mirekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeytskgnlvavv sdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfidivkaiaptfgginledia spkcfyilerlreeldipvfhddqqgtaavvlagllnalkvvgkkiseitlalfgagaagfatlrilte agvkpenvrvvelvngkpriltsdldleklfpyrgwllkktngenieggpqealkdadvlisftrpgpg vikpqwiekmnedaivfplanpvpeilpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrar titdsmiiaaakaiasiveepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirl iefyenviapinkkrreyskaitra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.24
    Matthews' coefficent 2.20 Rfactor 0.19
    Waters 232 Solvent Content 44.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ww8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch