.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Heme environmental structure of a novel artificial myoglobin with a closed heme pocket: site-specific chemical modification producing distal N-tetrazolylhistidine E7 by cyanogen bromide and azide ion. J.Am.Chem.Soc. 113 1826-1829 1991
    Site RSGI
    PDB Id 1wvp Target Id my_001000022.4
    Molecular Characteristics
    Source Physeter catodon
    Alias Ids TPS13691, Molecular Weight 17330.21 Da.
    Residues 154 Isoelectric Point 8.70
    Sequence mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtv ltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalel frkdiaakykelgyqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.53 Rfree 0.208
    Matthews' coefficent 2.30 Rfactor 0.174
    Waters 159 Solvent Content 45.90

    Ligand Information
    Ligands SO4 (SULFATE) x 2;HEM (PROTOPORPHYRIN) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wvp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch