The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the antifreeze-like domain of human sialic acid synthase. Protein Sci. 15 1010-1016 2006
    Site RSGI
    PDB Id 1wvo Target Id hss001002155.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13289, Molecular Weight 7267.17 Da.
    Residues 66 Isoelectric Point 4.99
    Sequence svvakvkipegtiltmdmltvkvgepkgyppedifnlvgkkvlvtveeddtimeelvdnhgkkiks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wvo

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch