.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wub

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a novel polyisoprenoid-binding protein from Thermus thermophilus HB8. Protein Sci. 14 1004-1010 2005
    Site RSGI
    PDB Id 1wub Target Id ttk003001927.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14823, Molecular Weight 19475.01 Da.
    Residues 178 Isoelectric Point 5.39
    Sequence mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgepqrdghlrsa dflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapikdpwgmqrvaasasgqin rkdwnltwnqvlelgallvgeevkfnleveavapapvaaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.26272
    Matthews' coefficent 2.21 Rfactor 0.21867
    Waters 102 Solvent Content 45.00

    Ligand Information
    Ligands OTP ((2E,6E,10E,14E,18E,22E,26E)-3,7,11,15,19,23,27,31-) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wub

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch