The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project ID PH0463 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1wu8 Target Id pho001000463.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13823, Molecular Weight 28613.74 Da.
    Residues 256 Isoelectric Point 5.70
    Sequence mitlttdfglkgpyvgemkvamlrinpnakivdvthsvtrhsilegsfvmeqvvkyspkgtvhvgvidp gvgterraiviegdqylvvpdnglatlplkhikvksvyeiipdkirkftgweisstfhgrdifgpagal iekgihpeefgreipvdsivklnveprkegdvwilkviyiddfgnvilnlenyekprtvelldfnlrlp yletyglvekgemlalpgshdyleiavnmgsaaerlnvkvgdelrvrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.228
    Matthews' coefficent 3.90 Rfactor 0.195
    Waters 273 Solvent Content 68.30

    Ligand Information
    Ligands ADN (ADENOSINE) x 3


    Google Scholar output for 1wu8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch