The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable nucleotidyltransferase protein from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wty Target Id ttk003001902.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14819, Molecular Weight 13932.26 Da.
    Residues 119 Isoelectric Point 5.33
    Sequence maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairgafqvgll pedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.28
    Matthews' coefficent 2.90 Rfactor 0.23
    Waters 120 Solvent Content 57.00

    Ligand Information


    Google Scholar output for 1wty

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch