.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ws9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project ID TT0172 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1ws9 Target Id ttk003000172.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14259, Molecular Weight 41521.23 Da.
    Residues 387 Isoelectric Point 5.60
    Sequence mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayggaglstr lfarmveaiayydgalaltvashxslatghillagseaqkeaflpklasgealgawgltepgsgsdaaa lktkaekveggwrlxgtkqfitqgsvagvyvvmartdpppsperkhqgisafaffrperglkvgrkeek lgltasdtaqliledlfvpeeallgergkgfydvlrvldggrigiaamavglgqaaldyalayakgrea fgrpiaefegvsfklaeaateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilg gygyvkdypverywrdarltrigegtseilklviarrlleav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.226
    Matthews' coefficent 2.40 Rfactor 0.18
    Waters 452 Solvent Content 48.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ws9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch