.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wrb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal RecA-like domain of a DEAD-box RNA helicase, the Dugesia japonica vasa-like gene B protein. J.Struct.Biol. 150 58-68 2005
    Site RSGI
    PDB Id 1wrb Target Id ar_001000069.1
    Molecular Characteristics
    Source Dugesia japonica
    Alias Ids TPS12120, Molecular Weight 88008.31 Da.
    Residues 781 Isoelectric Point 8.62
    Sequence nninvitdqmgnldiksndninqntqnsnvasdlnlltqnkylenilmmntygvnydhlflpqnvayla aqqlsnnimnnrnqinaaytsqqypnqsipikniydqshlkyqqnssswrpplnngniydgvksnpmgl hilqngidlytnvdsnsvtsainfdkydsipvsvtgpdysatnvienfdelkldptirnnillasyqrp tpiqknaipailehrdimacaqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiq ilsesqkfslntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldead rmldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgrvgstsdsikqei iymtdveklnylknifnttapntlilifvetkkgadslarfllskgypvssihgdrsqvereaalsmfr ngqcpilvatavaargldipnvkhvinydlpsdieeyvhrigrtgrlgnhgratsfyvdknnniaidlv dllkeanqivpqwlsaladelkrnstmgsnnkrhnqrrykngnfggrdyrqgpsnvnmnsgvnpdyfis gsvaprhaklnngnyfprsnelhdqhqkqnnnnnqvisntfhtgisashlipgyatfnrqqaplhfiph qtnntqflsssgqmalynrmqnsghmapnqrfpnepihhqqeqlpitynfsknlpylgqsysghnnnnn nnnntskindsdscyfgnktpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.2815
    Matthews' coefficent 1.99 Rfactor 0.241
    Waters 232 Solvent Content 38.25

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1wrb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch