.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization of the MIT domain from human Vps4b. Biochem.Biophys.Res.Commun. 334 460-465 2005
    Site RSGI
    PDB Id 1wr0 Target Id ar_001000797.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12218, Molecular Weight 9191.83 Da.
    Residues 81 Isoelectric Point 7.02
    Sequence gsdhmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakctey ldraeklkeylk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wr0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch