The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Src homology 2 domain from the human feline sarcoma oncogene Fes. J.Biomol.NMR 31 357-361 2005
    Site RSGI
    PDB Id 1wqu Target Id hss001002011.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13287, Molecular Weight 11498.65 Da.
    Residues 101 Isoelectric Point 6.04
    Sequence evqkplheqlwyhgaipraevaellvhsgdflvresqgkqeyvlsvlwdglprhfiiqsldnlyrlege gfpsipllidhllstqqpltkksgvvlhravp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wqu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch