The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of nonnatural amino acid recognition by an engineered aminoacyl-tRNA synthetase for genetic code expansion. Proc.Natl.Acad.Sci.USA 102 1366-1371 2005
    Site RSGI
    PDB Id 1wq3 Target Id eco001001308.4
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12268, Molecular Weight 47524.49 Da.
    Residues 424 Isoelectric Point 5.59
    Sequence massnlikqlqerglvaqvtdeealaerlaqgpialycgfdptadslhlghlvpllclkrfqqaghkpv alvggatgligdpsfkaaerklnteetvqewvdkirkqvapfldfdcgensaiaannydwfgnmnvltf lrdigkhfsvnqminkeavkqrlnredqgisftefsynllqgydfaclnkqygvvlqiggsdqwgnits gidltrrlhqnqvfgltvplitkadgtkfgkteggavwldpkktspykfyqfwintadadvyrflkfft fmsieeinaleeedknsgkapraqyvlaeqvtrlvhgeeglqaakriteclfsgslsalseadfeqlaq dgvpmvemekgadlmqalvdselqpsrgqarktiasnaitingekqsdpeyffkeedrlfgrftllrrg kknyclicwk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.219
    Matthews' coefficent 2.32 Rfactor 0.168
    Waters 302 Solvent Content 46.60

    Ligand Information
    Ligands IYR (3-IODO-TYROSINE) x 1


    Google Scholar output for 1wq3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch