.
The Open Protein Structure Annotation Network
PDB Keyword
.

1woy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methionyl tRNA synthetase Y225F mutant from Thermus thermophilus. TO BE PUBLISHED
    Site RSGI
    PDB Id 1woy Target Id ttk003000875.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14467, Molecular Weight 70689.73 Da.
    Residues 618 Isoelectric Point 6.04
    Sequence mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraaqaagedpka fvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyygeyeglycvscerfyteke lveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdlirpegyrnevlamlaepigdlsisrpk srvpwgiplpwdenhvtyvwfdallnyvsaldypegeayrtfwphawhligkdilkphavfwptmlkaa gipmyrhlnvggfllgpdgrkmsktlgnvvdpfallekygrdalryyllreipygqdtpvseealrtry eadladdlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkal nryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaerwgl aeprpipeeapvlfpkkeakveakpkeeawigiedfakvelrvaevlaaekhpnadrllvlrlslgnee rtvvsgiakwyrpeelvgkkvvlvanlkpaklrgiesqgmilaaqegealalvtvegevppgavvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.226
    Matthews' coefficent 3.25 Rfactor 0.189
    Waters 351 Solvent Content 62.13

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1woy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch