.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of two archaeal diphthine synthases: insights into the post-translational modification of elongation factor 2. Acta Crystallogr.,Sect.D 64 397-406 2008
    Site RSGI
    PDB Id 1wng Target Id pho001000725.45
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13896, Molecular Weight 29574.78 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.228
    Matthews' coefficent 3.20 Rfactor 0.198
    Waters 446 Solvent Content 61.20

    Ligand Information
    Ligands SO4 (SULFATE) x 6;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wng

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch