.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wna

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8. To be Published
    Site RSGI
    PDB Id 1wna Target Id ttk003001805.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14794, Molecular Weight 14182.81 Da.
    Residues 131 Isoelectric Point 7.97
    Sequence mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvpdafgpafpg geealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianptdpgiylkraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.229
    Matthews' coefficent 2.60 Rfactor 0.208
    Waters 117 Solvent Content 52.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wna

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch