The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8. To be Published
    Site RSGI
    PDB Id 1wn9 Target Id ttk003001805.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14793, Molecular Weight 14182.81 Da.
    Residues 131 Isoelectric Point 7.97
    Sequence mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvpdafgpafpg geealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianptdpgiylkraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.246
    Matthews' coefficent 2.44 Rfactor 0.214
    Waters 104 Solvent Content 49.21

    Ligand Information
    Ligands ACY (ACETIC) x 2


    Google Scholar output for 1wn9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch