.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wmw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of geranulgeranyl diphosphate synthase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1wmw Target Id ttk003000153.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14251, Molecular Weight 36500.94 Da.
    Residues 330 Isoelectric Point 5.57
    Sequence mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgapleagleaatale lfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllaeglarglfppevllefhev vrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytavaplrlgallagktppaayeegglrlgta fqivddvlnleggeaygkeragdlyegkrtlillrfleeappeeraralallalpreakpeaevgwlle rllasralawakaeakrlqaeglalleaafqdlpgkealdhlrgllaalverra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.198
    Matthews' coefficent 2.46 Rfactor 0.175
    Waters 1187 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wmw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch