.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wm9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel Reaction Mechanism of GTP Cyclohydrolase I. High-Resolution X-Ray Crystallography of Thermus thermophilus HB8 Enzyme Complexed with a Transition State Analogue, the 8-Oxoguanine Derivative. J.Biochem.(Tokyo) 138 263-275 2005
    Site RSGI
    PDB Id 1wm9 Target Id ttk003000188.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14264, Molecular Weight 24538.13 Da.
    Residues 220 Isoelectric Point 5.76
    Sequence mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllktpervakaw afltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfari vdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqkt reeflshlrdgta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.20 Rfree 0.261
    Matthews' coefficent 2.45 Rfactor 0.208
    Waters 346 Solvent Content 49.88

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 5

    Jmol

     
    Google Scholar output for 1wm9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch