.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wm6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Novel Induced-fit Reaction Mechanism of Asymmetric Hot Dog Thioesterase PaaI. J.Mol.Biol. 352 212-228 2005
    Site RSGI
    PDB Id 1wm6 Target Id ttk003000310.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14327, Molecular Weight 14261.42 Da.
    Residues 136 Isoelectric Point 6.41
    Sequence mrdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpavalscrmd yfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrlggdgddvpagtgnlaprea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.212
    Matthews' coefficent 4.50 Rfactor 0.192
    Waters 439 Solvent Content 72.60

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1wm6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch