.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wlm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of mouse CGI-38 protein. To be Published
    Site RSGI
    PDB Id 1wlm Target Id mmt007015745.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13562, Molecular Weight 14929.23 Da.
    Residues 138 Isoelectric Point 9.20
    Sequence maastdiagleesfrkfaihgdpkasgqemngknwaklckdckvadgkavtgtdvdivfskvkaksarv inyeefkkaleelatkrfkgkskeeafdaicqliagkepanigvtkaktggavdrltdtskytgshker
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wlm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch