.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wkc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wkc Target Id ttk003001367.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14706, Molecular Weight 20332.64 Da.
    Residues 184 Isoelectric Point 9.69
    Sequence mtkaelrrraraawrrldlkalsravgaallpwlrergfrhillyhplphelnllplmeayparyylpk vagkgltvhpfgplapgpfgllepttppedprvldlvvvpglafdregyrlghgqgfydrflkevraat vgvvpqallfpalprdpwdvpvdhlateagveavkrpapgpgglld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.25082
    Matthews' coefficent 2.70 Rfactor 0.21834
    Waters 146 Solvent Content 53.30

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1wkc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch