.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wkb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Leucyl-tRNA Synthetase from the Archaeon Pyrococcus horikoshii Reveals a Novel Editing Domain Orientation. J.Mol.Biol. 346 57-71 2005
    Site RSGI
    PDB Id 1wkb Target Id pho001000965.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13952, Molecular Weight 95491.13 Da.
    Residues 810 Isoelectric Point 6.10
    Sequence maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdviarfkrm qgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpinivkyfmkaaketfi ragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrvrwdpvvgtplgdhdlmegedvpil dyiiikfelrengeviylpaatlrpetvygvtnmwvnpnatyvkakvrrkdkeetwivskeaayklsfq dreievieefkgekligkyvrnpvsgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkretei lekydidprivenityisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvpp yegkpvqevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekarkale rmkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqeg kldpekltpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhltff ifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyimslaehdsdfdwr rkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaikettnaleefrtrtavqwafys imndlrwylrrtegrddeakryvlrtladvwvrlmapftphiceelweklg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.218
    Matthews' coefficent 3.19 Rfactor 0.18
    Waters 825 Solvent Content 61.43

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1wkb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch