.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wk8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for substrate recognition by the editing domain of isoleucyl-tRNA synthetase. J.Mol.Biol. 359 901-912 2006
    Site RSGI
    PDB Id 1wk8 Target Id ttk003000883.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14474, Molecular Weight 21462.47 Da.
    Residues 193 Isoelectric Point 5.46
    Sequence gykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealileegl grkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqapafgaedletar vyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkeesylhsyph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.249
    Matthews' coefficent 2.55 Rfactor 0.206
    Waters 274 Solvent Content 51.78

    Ligand Information
    Ligands VMS (5'O-[N-(L-VALYL)SULPHAMOYL]ADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wk8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch