The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Lectin C-type domain derived from a hypothetical protein from C. elegans. To be Published
    Site RSGI
    PDB Id 1wk1 Target Id cei001000012.1
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS12262, Molecular Weight 15412.11 Da.
    Residues 137 Isoelectric Point 4.93
    Sequence vkfltvnddilsmpqarnfcasaggyladdlgddknnfyssiaantqfwiglfknsdgqfywdrgqgin pdllnqpitywangepsndptrqcvyfdgrsgdkskvwttdtcatprpficqkhrydsdhkpntigda
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wk1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch