The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of zf-C2H2 domains from human Zinc finger protein 295. To be Published
    Site RSGI
    PDB Id 1wjp Target Id hsk002001201.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12636, Molecular Weight 10971.01 Da.
    Residues 94 Isoelectric Point 8.47
    Sequence aspvenkevyqcrlcnaklsslleqgsherlcrnaavcpycslrffspelkqeheskceykkltclecm rtfkssfsiwrhqvevhnqnnmapt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 3


    Google Scholar output for 1wjp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch