The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PDZ domain of mouse Cypher protein. To be Published
    Site RSGI
    PDB Id 1wjl Target Id mmt007001185.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13468, Molecular Weight 8870.60 Da.
    Residues 83 Isoelectric Point 9.22
    Sequence msysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaidgvntdtmthleaqnki ksasynlsltlqks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wjl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch