The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of hypothetical protein C330018D20Rik from Mus musculus. To be Published
    Site RSGI
    PDB Id 1wjk Target Id mmt007016800.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13566, Molecular Weight 10252.42 Da.
    Residues 87 Isoelectric Point 8.66
    Sequence nlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwyerykfdipvfhlngqf lmmhrvntsklekqlrkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wjk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch